Idi na sadržaj

CCL4

S Wikipedije, slobodne enciklopedije
CCL4L1
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

1HUM, 1HUN, 1JE4, 2FFK, 2FIN, 2X6L, 3TN2, 4RAL

Identifikatori
AliasiCCL4L1
Vanjski ID-jeviOMIM: 603782 GeneCards: CCL4L1
Ontologija gena
Molekularna funkcija chemokine activity
cytokine activity
GO:0001948, GO:0016582 vezivanje za proteine
CCR chemokine receptor binding
CCR5 chemokine receptor binding
CCR1 chemokine receptor binding
vezivanje identičnih proteina
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces lymphocyte chemotaxis
chemokine-mediated signaling pathway
cellular response to tumor necrosis factor
G protein-coupled receptor signaling pathway
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
Hemotaksija
inflammatory response
cellular response to interleukin-1
monocyte chemotaxis
neutrophil chemotaxis
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
positive regulation of ERK1 and ERK2 cascade
cellular response to interferon-gamma
regulation of signaling receptor activity
eosinophil chemotaxis
positive regulation of calcium-mediated signaling
positive regulation of natural killer cell chemotaxis
cell-cell signaling
response to virus
establishment or maintenance of cell polarity
Ćelijska adhezija
response to toxic substance
GO:0072468 Transdukcija signala
positive regulation of calcium ion transport
cytokine-mediated signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_207007

n/a

RefSeq (bjelančevina)

NP_996890
NP_002975

n/a

Lokacija (UCSC)n/an/a
PubMed pretraga[1]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Hemokinski (C-C motivni) ligand 4, znan i kao CCL4, je protein koji je kod ljudi kodiran genom CCL4.[2]

Dužina polipeptidnog lanca je 92 aminokiseline, a molekulska težina 10.212 Da[3]

Aminokiselinska sekvenca

Simboli
1020304050
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVD
YYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Funkcija[uredi | uredi izvor]

CCL4, poznat i kao makrofagni upalni protein – 1β (MIP-1β) je CC-hemokin sa specifičnošću za CCR5 receptore. To je hemoatraktant za prirodne ćelije ubice, monocite i niz drugih imunskih ćelija.[4]

CCL4 je glavni HIV-supresivni faktor koga proizvode CD8 + T-ćelije.[5]

Perforin niskomemorijski CD8+ T-ćelije koje normalno sintetizira MIP-1-beta.[6]

CCL4 proizvode: neutrofili, monociti, B-ćelije, T-ćelije, fibroblasti, endotelne i epitelne ćelije.[7]

Pokazalo se da je koncentracija ovog hemokina u obrnutoj vezi sa mikroRNK-125b. Koncentracija CCL4 u tijelu raste s godinama, što može uzrokovati hroničnu upalu i oštećenje jetre.[7][8]

Interakcije[uredi | uredi izvor]

Pokazano je da CCL4 komunicira sa CCL3.[9]

CCL4 se veže za receptore povezane sa G-proteinima CCR5 i CCR8.[7]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  2. ^ Irving SG, Zipfel PF, Balke J, McBride OW, Morton CC, Burd PR, Siebenlist U, Kelly K (juni 1990). "Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q". Nucleic Acids Research. 18 (11): 3261–70. doi:10.1093/nar/18.11.3261. PMC 330932. PMID 1972563.
  3. ^ "UniProt, P13236". Pristupljeno 27. 6. 2021.
  4. ^ Bystry RS, Aluvihare V, Welch KA, Kallikourdis M, Betz AG (decembar 2001). "B cells and professional APCs recruit regulatory T cells via CCL4". Nature Immunology. 2 (12): 1126–32. doi:10.1038/ni735. PMID 11702067. S2CID 7901253.
  5. ^ Cocchi F, DeVico AL, Garzino-Demo A, Arya SK, Gallo RC, Lusso P (decembar 1995). "Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells". Science. 270 (5243): 1811–5. Bibcode:1995Sci...270.1811C. doi:10.1126/science.270.5243.1811. PMID 8525373. S2CID 84062618.
  6. ^ Kamin-Lewis R, Abdelwahab SF, Trang C, Baker A, DeVico AL, Gallo RC, Lewis GK (juli 2001). "Perforin-low memory CD8+ cells are the predominant T cells in normal humans that synthesize the beta -chemokine macrophage inflammatory protein-1beta". Proceedings of the National Academy of Sciences of the United States of America. 98 (16): 9283–8. Bibcode:2001PNAS...98.9283K. doi:10.1073/pnas.161298998. PMC 55412. PMID 11470920.
  7. ^ a b c Morrison MD, Lundquist PG (april 1974). "Labyrinthine morphology and temperature in cryosurgery (guinea pig)". Acta Oto-Laryngologica. 77 (4): 261–73. doi:10.1111/acel.12294. PMC 4364832. PMID 25620312.
  8. ^ Morimoto T, Takagi H, Kondo T (januar 1985). "Canine pancreatic allotransplantation with duodenum (pancreaticoduodenal transplantation) using cyclosporin A". Nagoya Journal of Medical Science. 47 (1–2): 57–66. PMID 3887178.
  9. ^ Guan E, Wang J, Norcross MA (april 2001). "Identification of human macrophage inflammatory proteins 1alpha and 1beta as a native secreted heterodimer". The Journal of Biological Chemistry. 276 (15): 12404–9. doi:10.1074/jbc.M006327200. PMID 11278300.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]